Fibrino Gens

Welcome on Fibrinogen Alpha antibody page

Fibrinogen Alpha antibody

General information

Catalog number
70R-5273
Name
Fibrinogen Alpha antibody
Price
475.00 EUR
Size
50 µg

Detailed information

Category
Primary Antibody
Antibody Subtype
Polyclonal Antibodies, Purified
Area of research
Cell Biology
Type of Immunogen
Fibrinogen Alpha antibodies were raised using the middle region of FGA corresponding to a region with amino acids SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK
Raised in
Rabbit
Specificity
Fibrinogen Alpha antibody was raised against the middle region of FGA
Cross Reactivity
Human
Method of Purification
Affinity purified
Concentration
1 mg/ml
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGA antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions
Blue Ice
Tested for
WB
Usage Recommendations
WB: 1 ug/ml
Assay Information
Fibrinogen Alpha Blocking Peptide, catalog no. 33R-8855, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody
Additional Information
This is a rabbit polyclonal antibody against FGA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Description
The Fibrinogen Alpha antibody is a α- or alpha protein sometimes glycoprotein present in blood.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation
anticorps