Fibrino Gens

Welcome on Fibrinogen Alpha antibody page

Fibrinogen Alpha antibody

General information

Catalog number
70R-1553
Name
Fibrinogen Alpha antibody
Price
438.00 EUR
Size
100 µg

Detailed information

Category
Primary Antibody
Antibody Subtype
Polyclonal Antibodies, Purified
Area of research
Cell Biology
Type of Immunogen
Fibrinogen Alpha antibodies were raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
Raised in
Rabbit
Specificity
Fibrinogen Alpha antibody was raised against the N terminal of FGA
Cross Reactivity
Human
Method of Purification
Total IgG Protein A purified
Concentration
1 mg/ml
Form & Buffer
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FGA antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions
Blue Ice
Tested for
WB; IHC
Usage Recommendations
WB: 5 ug/ml; IHC: 4-8 ug/ml
Assay Information
Fibrinogen Alpha Blocking Peptide, catalog no. 33R-6003, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody
Additional Information
This is a rabbit polyclonal antibody against FGA. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Description
The Fibrinogen Alpha antibody is a α- or alpha protein sometimes glycoprotein present in blood.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation
anticorps