Fibrino Gens

Welcome on FGB Antibody page

FGB Antibody

General information

Catalog number
A01204-1
Name
FGB Antibody
Price
374.00 EUR
Size
0,1 mg

Detailed information

Target antigen
FGB
Clonality
Polyclonal antibody
Clone
Polyclonal antibody
Raised in
rabbit
Type of the antibody
IgG polyclonal antibody
Product form
freeze-dried
Reacts with species:
mouse, rat
Analyses
WB
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification
Immunogen affinity purified.
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
Storage condtions
Keep the FGB Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
Tips
The FGB Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
Background
Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Related articles
1. "Entrez Gene: FGB fibrinogen beta chain". 2. Chung, D. W., Que, B. G., Rixon, M. W., Mace, M., Jr., Davie, E. W. Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen. Biochemistry 22: 3244-3250, 1983. 3. Spena, S., Duga, S., Asselta, R., Malcovati, M., Peyvandi, F., Tenchini, M. L. Congenital afibrinogenemia: first identification of splicing mutations in the fibrinogen B-beta-chain gene causing activation of cryptic splice sites. Blood 100: 4478-4484, 2002.
Gene Name
FGB
Protein Name
Fibrinogen beta chain
Gene Full Name
fibrinogen beta chain
Synonyms
FGB | Fibrinogen beta chain | Fibrinopeptide B | HEL S 78p | HEL-S-78p | P02675
Uniprot ID
P02675
Entrez GeneID
2244
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation
anticorps