Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
Specificity
Fibrinogen Alpha antibody was raised against the N terminal of FGA
Cross Reactivity
Human
Clone
NA
Concentration
1 mg/ml
Form & Buffer
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FGA antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Info
Blue Ice
Description
The Rabbit Fibrinogen Alpha antibody is a α- or alpha protein sometimes glycoprotein present in blood.
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
About
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.