Fibrinogen Alpha antibody

General information

Catalog number

70R-5273

Name

Price

475.00 EUR

Size

50 µg

Go to shop

Detailed information

Category

Primary Antibody

Antibody Subtype

Polyclonal Antibodies, Purified

Area of research

Cell Biology

Type of Immunogen

Fibrinogen Alpha antibodies were raised using the middle region of FGA corresponding to a region with amino acids SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK

Raised in

Rabbit

Specificity

Fibrinogen Alpha antibody was raised against the middle region of FGA

Cross Reactivity

Human

Method of Purification

Affinity purified

Concentration

1 mg/ml

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGA antibody in PBS

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping conditions

Blue Ice

Tested for

Usage Recommendations

WB: 1 ug/ml

Assay Information

Fibrinogen Alpha Blocking Peptide, catalog no. 33R-8855, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody

Additional Information

This is a rabbit polyclonal antibody against FGA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]

Description

The Fibrinogen Alpha antibody is a α- or alpha protein sometimes glycoprotein present in blood.

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

French translation

anticorps